PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG038389t1
Common NameTCM_038389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HB-other
Protein Properties Length: 434aa    MW: 49566.4 Da    PI: 8.7507
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG038389t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-09251297652
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       +++k q+e+Le+++++++ p+ +++  + + ++L+ ++V  WF  +R
  Thecc1EG038389t1 251 RLKKVQVETLEKVYRRSKRPTNAMISSIVQVTNLPRKKVVKWFEDKR 297
                       57899***************************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.799243303IPR001356Homeobox domain
CDDcd000861.33E-6246297No hitNo description
SuperFamilySSF466893.04E-9246309IPR009057Homeodomain-like
SMARTSM003893.9E-5249307IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-8251299IPR009057Homeodomain-like
PfamPF000469.3E-7251297IPR001356Homeobox domain
PfamPF156973.1E-9332362IPR031421Protein of unknown function DUF4666
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:0098869Biological Processcellular oxidant detoxification
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0004601Molecular Functionperoxidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MALRLLPFFS CSGRVFITQP RPFDVLLPRQ SPRPSILAFS RRRSNTPSTT SSVKKKKVKK  60
EKKGLVEEDD FDGDPFEALF SQLEEDLKND NSDIEDDDDY DEIKEEDVDR LASELADALG  120
NFDLEAFTST PDDAEEEEEE RPVKLKNWQL RRLAAAVKVG RRKTSIKSLA TELCLDRHVV  180
LELLREPPPE LLMLSATLPD EPPKREPVLE TKPVEPVALE TTVDSVKHEP KEPKVKEPVH  240
VMQHRWSAQK RLKKVQVETL EKVYRRSKRP TNAMISSIVQ VTNLPRKKVV KWFEDKRNED  300
GIPEHHQPYQ SLKQQRFCVS YCTTSNRVQK NMATLQRSAV SFRREGSSGS VWDDLYVLGE  360
DGTVHYRDQL RPCQSTRERS SSTPVPNACP RSMSTPAMDP SSLIKVFGKL SREDKPFPEV  420
PKLPQSKSKK HKA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14056RRRSNTPSTTSSVKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007013839.10.0Overexpressor of cationic peroxidase 3, putative
SwissprotQ8H0V51e-75OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLA0A061GPW00.0A0A061GPW0_THECC; Overexpressor of cationic peroxidase 3, putative
STRINGVIT_04s0008g05190.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120772631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-53overexpressor of cationic peroxidase 3
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]